General Information

  • ID:  hor006262
  • Uniprot ID:  Q16661
  • Protein name:  Guanylate cyclase C-activating peptide 2
  • Gene name:  GUCA2B
  • Organism:  Homo sapiens (Human)
  • Family:  Guanylin family
  • Source:  Human
  • Expression:  Stomach and intestine.
  • Disease:  Diseases associated with GUCA2B include Cataract 8, Multiple Types and Colorectal Cancer.
  • Comments:  NA
  • Taxonomy:   Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005515 protein binding; GO:0030250 guanylate cyclase activator activity
  • GO BP:  GO:0019934 cGMP-mediated signaling
  • GO CC:  GO:0005576 extracellular region; GO:0070062 extracellular exosome

Sequence Information

  • Sequence:  FKTLRTIANDDCELCVNVACTGCL
  • Length:  24(89-112)
  • Propeptide:  MGCRAASGLLPGVAVVLLLLLQSTQSVYIQYQGFRVQLESMKKLSDLEAQWAPSPRLQAQSLLPAVCHHPALPQDLQPVCASQEASSIFKTLRTIANDDCELCVNVACTGCL
  • Signal peptide:  MGCRAASGLLPGVAVVLLLLLQSTQS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins. May be a potent physiological regulator of intestinal fluid and electrolyte transport. May be an auto
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  12-20; 15-23
  • Structure ID:  AF-Q16661-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006262_AF2.pdbhor006262_ESM.pdb

Physical Information

Mass: 301350 Formula: C108H180N30O36S4
Absent amino acids: HMPQSWY Common amino acids: C
pI: 4.37 Basic residues: 2
Polar residues: 10 Hydrophobic residues: 9
Hydrophobicity: 51.25 Boman Index: -2529
Half-Life / Aliphatic Index: 1.1 hour Aliphatic Index: 97.5
Instability Index: 4458.33 Extinction Coefficient cystines: 250
Absorbance 280nm: 10.87

Literature

  • PubMed ID:  8605041
  • Title:  Cloning and characterization of a cDNA encoding a precursor for human uroguanylin.
  • PubMed ID:  8519795
  • Title:  A new human guanylate cyclase-activating peptide (GCAP-II, uroguanylin): precursor cDNA and colonic expression.
  • PubMed ID:  9268639
  • Title:  Genomic structure and chromosomal localization of human ur
  • PubMed ID:  15489334
  • Title:  
  • PubMed ID:  7589507
  • Title:  
  • PubMed ID:  8141334
  • Title:  
  • PubMed ID:  9774236
  • Title: